Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy?

Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. scored 68/100 — Use Caution.

CheckIt score 68/100. contains soybean oil, sunflower oil.

Scan Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. in the App →

✅ No common allergens detected

🛢️ Seed Oils Found

soybean oil sunflower oil

Full Ingredients List

Roasted Potatoes, Broccoli, Herb Coated Cooked Chicken (Chicken Breast, Water, Olive Oil, Less Than 2% Of: Isolated Soy Protein Product [Isolated Soy Protein, Modified Potato Starch, Corn Starch, Carrageenan, Soy Lecithin], Salt, Dextrose, Maltodextrin, Garlic Powder, Potassium Chloride, Sodium Phosphate, Onion Powder, Black Pepper, Parsley, Ground Celery Seed, Thyme, Flavoring), Soybean Oil, Rosemary Brown Butter Seasoning (Salt, Sugar, Brown Sugar, Maltodextrin, Nonfat Dry Milk, Garlic Powder, Spice, Butter [Cream, Annatto], Whey Powder, Onion Powder, Buttermilk Powder, Sunflower Oil, Modified Corn Starch, Medium Chain Triglycerides, Natural Flavor, Disodium Phosphate). CONTAINS: MILK, SOY

Nutrition Facts

🔄 Healthier Alternatives

ProductBrandScore
P.F. Chang's Home Menu General Chang's Chicken Skillet Meal, Frozen Meal, 22 oz.Conagra Brands, Inc73/100
📬

Get Your Free Weekly Clean Food Guide

Join health-conscious shoppers. Every week: worst products to avoid, cleanest new finds, and FDA recall alerts.

No spam. Unsubscribe anytime.

Frequently Asked Questions

Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. healthy?
Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. scored 68/100 on CheckIt AI's health analysis. Use Caution. CheckIt score 68/100. contains soybean oil, sunflower oil.
What allergens does Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. contain?
No common allergens were detected in Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz..
Does Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. contain seed oils?
Yes, Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. contains: soybean oil, sunflower oil.
Does Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. have artificial additives?
No concerning additives were found in Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz..
What is the healthiest alternative to Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz.?
The top alternative is P.F. Chang's Home Menu General Chang's Chicken Skillet Meal, Frozen Meal, 22 oz. by Conagra Brands, Inc with a score of 73/100.
CheckIt AI
CheckIt AI
★★★★★ 4.7 · 213+ reviews

See what's really in your food

Scan any food label instantly. No barcode needed. 26,000+ products scored.

Download Free on the App Store →

Free · No credit card required · Works on iPhone & Android

📋 Cite This Data
APACheckIt AI. (2026). "Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy? Score: 68/100 | CheckIt AI". Climaverse PBC. Retrieved from https://getcheck.it/is-it-healthy/conagra-brands-inc-birds-eye-sheet-pan-meals-chicken-with-rosemary-brown-butter-potatoes-frozen-meal-117e2d
MLA"Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy? Score: 68/100 | CheckIt AI." CheckIt AI, Climaverse PBC, 2026-03-12. https://getcheck.it/is-it-healthy/conagra-brands-inc-birds-eye-sheet-pan-meals-chicken-with-rosemary-brown-butter-potatoes-frozen-meal-117e2d.
HTML Embed<a href="https://getcheck.it/is-it-healthy/conagra-brands-inc-birds-eye-sheet-pan-meals-chicken-with-rosemary-brown-butter-potatoes-frozen-meal-117e2d">Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy? Score: 68/100 | CheckIt AI — CheckIt AI</a>
BibTeX@misc{checkit2026isithealthyconagrabrandsincbirdseyesheetpanmealschickenwithrosemarybrownbutterpotatoesfrozenmeal117e2d, title = {Is Birds Eye Sheet Pan Meals, Chicken with Rosemary Brown Butter Potatoes, Frozen Meal, 31 oz. Healthy? Score: 68/100 | CheckIt AI}, author = {CheckIt AI}, year = {2026}, publisher = {Climaverse PBC}, url = {https://getcheck.it/is-it-healthy/conagra-brands-inc-birds-eye-sheet-pan-meals-chicken-with-rosemary-brown-butter-potatoes-frozen-meal-117e2d}, note = {Retrieved 2026-03-12} }